/ 6 9 9 7 4 2 / 6 2 8 3 1 5 / 7 1 7 2 2 8 / 9 3 6 5 5 7 / 8 1 3 3 8 6 / 5 1 9 2 2 5 /

http://www.novusbio.com/MC148-Protein_NBP1-46264-50-ug.html

  Quote

 

Theoretical Sequence: LARRKCCLNPTNRPIPNPLL QDLSRVDYQAIGHDCGREAFRVTLQDGRQG CVSVGNKSLLDWLRGHKDLCPQIWSGCESL YSRAKVDKKVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCRVSN KALPAPIEKTISKAKGQPREPQVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK

 

spambot

where my feeling friday was this could be out any minute, now my feeling is kind of that this could still be a while. not a bad thing by any means

  On 4/28/2013 at 9:49 PM, qaz said:

 

Saw this on the #boardsofcanada live feed on Twitter.

 

Google Translate says: "Do you like Boards of Canada? Grabs the MC148 tomorrow for a little uncommon sweetness."

 

Whatever that means...

probably will be another transmission....

  On 4/28/2013 at 9:49 PM, qaz said:

 

Saw this on the #boardsofcanada live feed on Twitter.

 

Google Translate says: "Do you like Boards of Canada? Grabs the MC148 tomorrow for a little uncommon sweetness."

 

Whatever that means...

Looks like a podcast after doing a google search, I'm guessing they're going to be playing some boc tunes on their show tomorrow.

MC148 = Morceaux Choisis podcast #148. Probably unrelated, it'd be a weird place to put out the last broadcast at least.

uncommon sweetness might be a cultural/bad translation as "weird/unique occurrence"

  On 4/28/2013 at 10:04 PM, Aserinsky said:

MC148 = Morceaux Choisis podcast #148. Probably unrelated, it'd be a weird place to put out the last broadcast at least.

true considering how balls-out-big-time the last few have been

I really start to think there is some connection to Saturn. It has hexagon on it`s north pole, tonight it`s gonna come as close to earth as it can be (at ~20:30 gmt, video at rough trade said "20:35?") Also god Saturn in roman mythology "was seen as a god of generation, dissolution, plenty, wealth, agriculture, periodical renewal and liberation" they reckoned "Saturn is a wielder of lightning, had a magical lordship over creation and destruction" and "Saturn is associated with a major religious festival in the Roman calendar, Saturnalia. Saturnalia celebrated the harvest and sowing" and in spanish "En la mitología romana Saturno (en latín Saturnus) era un importante dios de la agricultura y la cosecha". Or maybe I`m going all foucault pendulum on this...lol

one pattern i was thinking was that there are six numbers in each string, and that the total string is six across

I'm sure someone has thought of this as the number 6 is relevant obviously

the idea would then be that the outer pattern related to the inner pattern of each, you might even be able to deduce the fifth spot logically using this method

1 2 3 4 5 6

p1 p2 p3 p4 p5 p6

123456

699742

123456

628315

123456

717228

123456

936557

123456

XXXXXX

123456

519225

haven't been following the decode attempts so i dk if this is obsolete

http://m.youtube.com/#/watch?v=rFZS3spi0Xw&desktop_uri=%2Fwatch%3Fv%3DrFZS3spi0Xw

pause at 0:41

edit: posted in bocpages facebook some minutes ago.

  On 4/28/2013 at 10:11 PM, MIXL2 said:

http://m.youtube.com/#/watch?v=rFZS3spi0Xw&desktop_uri=%2Fwatch%3Fv%3DrFZS3spi0Xw

 

pause at 0:41

 

edit: posted in bocpages facebook some minutes ago.

  On 4/28/2013 at 10:09 PM, zemudene said:

I really start to think there is some connection to Saturn. It has hexagon on it`s north pole, tonight it`s gonna come as close to earth as it can be (at ~20:30 gmt, video at rough trade said "20:35?") Also god Saturn in roman mythology "was seen as a god of generation, dissolution, plenty, wealth, agriculture, periodical renewal and liberation" they reckoned "Saturn is a wielder of lightning, had a magical lordship over creation and destruction" and "Saturn is associated with a major religious festival in the Roman calendar, Saturnalia. Saturnalia celebrated the harvest and sowing" and in spanish "En la mitología romana Saturno (en latín Saturnus) era un importante dios de la agricultura y la cosecha". Or maybe I`m going all foucault pendulum on this...lol

oh my god it doesn't come that close

it's like taking two steps and saying you're closer to the opposite side of the earth

  On 4/28/2013 at 10:13 PM, NorthernFusion said:

 

  On 4/28/2013 at 10:11 PM, MIXL2 said:

 

http://m.youtube.com/#/watch?v=rFZS3spi0Xw&desktop_uri=%2Fwatch%3Fv%3DrFZS3spi0Xw

 

pause at 0:41

 

edit: posted in bocpages facebook some minutes ago.

Yeah, totally unrelated... right?

  On 4/28/2013 at 10:14 PM, MIXL2 said:

 

  On 4/28/2013 at 10:13 PM, NorthernFusion said:

 

  On 4/28/2013 at 10:11 PM, MIXL2 said:

http://m.youtube.com/#/watch?v=rFZS3spi0Xw&desktop_uri=%2Fwatch%3Fv%3DrFZS3spi0Xw

 

pause at 0:41

 

edit: posted in bocpages facebook some minutes ago.

Yeah, totally unrelated... right?

 

Well, it isn't the Warp logo (judging from 720p). However, maybe John Cusack is involved after all.

So I'm looking at a six digit number inside some movie trailer? I could understand the game behind this all being a promo for a new movie (instead of a new boc album) - given the link with california/hollywood on that desert thing. But that number? Nah....

lol, I can see the interviews now:

  Quote

Boards Of Canada on the delay of the new album: "Yeah, we've been sitting on it for years, but some muppet in Warp PR thought it'd be a good idea to strike a deal with Kaspar Barfoeld where we slipped in a little cryptic clue in his film after an unusually large coke binge in Shoreditch. We've basically been waiting for Barfoeld to pull his finger out his bum for 5 years to release this film just so we could start with the whole cryptic campaign and release the album. The worst thing? The film isn't that good, not to mention that binge also led to My Best Fiend getting signed."

lol

Maconie's Freak Zone on BBC6 music just played a code!

Alas it was a repeat of the 6th in the sequence.

Apparently a number has just been played on BBC Radio 6...?

It's 519225 again. Thanks bawk.

  On 4/28/2013 at 10:33 PM, Gravity said:

It's 519225 again. Thanks bawk.

i've officially lost patience with this whole thing

  On 4/28/2013 at 10:37 PM, LimpyLoo said:

 

  On 4/28/2013 at 10:33 PM, Gravity said:

It's 519225 again. Thanks bawk.

 

i've officially lost patience with this whole thing

 

lol

edit: @ limpy

why? I swear people are spoiled. As I noted many posts ago, there's redundancy built into the system. Yes, it would have been nice if they could have "recalled" the redundant codes. But I see no reason to be angry or super frustrated. It's STILL better than a standard promotional campaign. Though the Geogaddi "church listening party" approach was perhaps the best...

nope you're wrong. best promotional campaign includes an official announcement of when you will be able to give your money to them in exchange for said product,

at the moment there is no product, no announcement. only hype.

great promotional campaign :thumbsup:

tomorrow i'm sure i will have a fresh outlook again

but for the moment i'm still frustrated and bummed-out